PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04381.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 406aa    MW: 44798.4 Da    PI: 9.4295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04381.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-1797144148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WTt+Ed+ll++ v+q+G g+W+++ ++ g++R +k+c++rw +yl
  Zmw_sc04381.1.g00050.1.am.mk  97 KGPWTTQEDKLLIEHVRQHGEGRWNSVCKHTGLKRGGKSCRLRWVNYL 144
                                   79******************************99************97 PP

2Myb_DNA-binding53.65e-17150194147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc04381.1.g00050.1.am.mk 150 RGKITPQEERIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 194
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.48892144IPR017930Myb domain
SuperFamilySSF466892.57E-2895191IPR009057Homeodomain-like
SMARTSM007174.5E-1596146IPR001005SANT/Myb domain
PfamPF002492.5E-1697144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2298151IPR009057Homeodomain-like
CDDcd001672.46E-1199144No hitNo description
PROSITE profilePS5129426.063145199IPR017930Myb domain
SMARTSM007172.8E-16149197IPR001005SANT/Myb domain
PfamPF002491.2E-14150194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-24152197IPR009057Homeodomain-like
CDDcd001673.94E-11154195No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MCRSKGTRST FMHPSPVTAR QLRTCPSDQD TRYRSRARMR EPRCTAITGL MARTTSSGDW  60
NSPDKDVAFG ERQGRIELAS MEGQLSWGRQ EVDGWRKGPW TTQEDKLLIE HVRQHGEGRW  120
NSVCKHTGLK RGGKSCRLRW VNYLRPDLKR GKITPQEERI IVQLHALWGN RWSTIARSLP  180
GRTDNEIKNY WRTHFKKGKP SKNIEIARAR FLKQRREMQC PQQQQQVQLV NKNEDTKLHA  240
TRTAGTVKVD ADRGSAVVDN ACPATTTAAA ADQSGHQQAA DLIIHDVIMD FMCPMSCSLL  300
LHGAGAHQGA AGAGSCCGST SEEYGSSEED GATWGSLWNL EDIVVDGGGG ACSLWWGRGE  360
RSTARGVKHP SAHQLDPVAA VVLVDNDGTT TAVRPLCSSS GGSRLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-279719727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-117PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-117K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584